"kaiserpermanente.org" - search results


 

We found 1 result(s) for kaiserpermanente.org

com/.org/.net or .eu version of domain kaiserpermanente.org is likely to be available.
Click here to register the domain.

Nr. Domain name IP Registered on
  Domain: kaiserpermanente.org

Tools
- traceroute
- ping

For more tools and details click here
· 162.119.234.68
· More domains hosted on 162.119.234.68
 
N/A
1 Domain: k9wzrepeater.org
· 72.42.204.61
· More domains hosted on 72.42.204.61
 
N/A
2 Domain: kackarprojesi.org
· 68.178.254.175
· More domains hosted on 68.178.254.175
 
N/A
3 Domain: kacrph.org
· 65.55.194.74
· More domains hosted on 65.55.194.74
 
N/A
4 Domain: kacyrafamily.org
· 205.178.189.131
· More domains hosted on 205.178.189.131
 
N/A
5 Domain: kacyrafamilyfoundation.org
· 216.39.58.113
· More domains hosted on 216.39.58.113
 
N/A
6 Domain: kacyrafoundation.org
· 205.178.189.131
· More domains hosted on 205.178.189.131
 
N/A
7 Domain: kaeserblog.org
· 209.62.20.225
· More domains hosted on 209.62.20.225
 
N/A
8 Domain: kaeserblogs.org
· 205.178.189.131
· More domains hosted on 205.178.189.131
 
N/A
9 Domain: kagawa-rff.org
· 202.218.79.76
· More domains hosted on 202.218.79.76
 
N/A
10 Domain: kagerbauer.org
· 217.20.114.214
· More domains hosted on 217.20.114.214
 
N/A
11 Domain: kagerplassen.org
· 213.188.130.108
· More domains hosted on 213.188.130.108
 
N/A
12 Domain: kagriffiths.org
· 74.208.80.233
· More domains hosted on 74.208.80.233
 
N/A
13 Domain: kagyu-europe.org
· 62.116.168.61
· More domains hosted on 62.116.168.61
 
N/A
14 Domain: kaieserpermanente.org
· 216.188.26.237
· More domains hosted on 216.188.26.237
· 216.188.26.235
· More domains hosted on 216.188.26.235
 
N/A
15 Domain: kaisarpermanente.org
· 64.20.62.35
· More domains hosted on 64.20.62.35
· 64.20.60.99
· More domains hosted on 64.20.60.99
· 64.20.60.106
· More domains hosted on 64.20.60.106
 
N/A
16 Domain: kaiseerpermanente.org
· 216.188.26.237
· More domains hosted on 216.188.26.237
· 216.188.26.235
· More domains hosted on 216.188.26.235
 
N/A
17 Domain: kaiser-finanz.org
· 82.165.74.132
· More domains hosted on 82.165.74.132
 
N/A
18 Domain: kaiser-frazer.org
· 68.178.232.100
· More domains hosted on 68.178.232.100
 
N/A
19 Domain: kaiser-partner.org
· 82.165.48.187
· More domains hosted on 82.165.48.187
 
N/A
20 Domain: kaiser-permanente.org
· 209.11.136.180
· More domains hosted on 209.11.136.180
 
N/A
21 Domain: kaiser-permanete.org
· 69.46.228.160
· More domains hosted on 69.46.228.160
 
N/A
22 Domain: kaiser-permante.org
· 64.20.60.99
· More domains hosted on 64.20.60.99
· 64.20.60.106
· More domains hosted on 64.20.60.106
· 64.20.62.35
· More domains hosted on 64.20.62.35
 
N/A
23 Domain: kaiserbehealthy.org
· 205.210.42.13
· More domains hosted on 205.210.42.13
 
N/A
24 Domain: kaiserbilly.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
25 Domain: kaiserblick.org
· 195.3.86.166
· More domains hosted on 195.3.86.166
 
N/A
26 Domain: kaiserblows.org
· 192.168.1.0
· More domains hosted on 192.168.1.0
 
N/A
27 Domain: kaiserbrunn.org
· 81.223.238.231
· More domains hosted on 81.223.238.231
 
N/A
28 Domain: kaiserfairfield.org
· 216.70.102.168
· More domains hosted on 216.70.102.168
 
N/A
29 Domain: kaiserfamily.org
· 216.21.239.197
· More domains hosted on 216.21.239.197
 
N/A
30 Domain: kaiserfamilyfoundation.org
· 216.65.123.248
· More domains hosted on 216.65.123.248
 
N/A
31 Domain: kaiserfederal.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
32 Domain: kaiserfederalbank.org
· 204.251.15.151
· More domains hosted on 204.251.15.151
 
N/A
33 Domain: kaiserfederalfinancial.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
34 Domain: kaiserfederalfinancialgroup.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
35 Domain: kaiserfederalgroup.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
36 Domain: kaiserfilms.org
· 66.195.251.174
· More domains hosted on 66.195.251.174
 
N/A
37 Domain: kaiserfirstedition.org
· 205.178.189.131
· More domains hosted on 205.178.189.131
 
N/A
38 Domain: kaiserfolsom.org
· 216.243.74.30
· More domains hosted on 216.243.74.30
 
N/A
39 Domain: kaiserfoundation.org
· 205.178.189.131
· More domains hosted on 205.178.189.131
 
N/A
40 Domain: kaiserfrazer.org
· 68.178.232.100
· More domains hosted on 68.178.232.100
 
N/A
41 Domain: kaiserfremont.org
· 216.243.74.30
· More domains hosted on 216.243.74.30
 
N/A
42 Domain: kaiserfresno.org
· 216.243.74.30
· More domains hosted on 216.243.74.30
 
N/A
43 Domain: kaiserfund.org
· 98.136.50.188
· More domains hosted on 98.136.50.188
 
N/A
44 Domain: kaiserhof.org
· 213.174.50.61
· More domains hosted on 213.174.50.61
 
N/A
45 Domain: kaiserhoff.org
· 66.60.193.40
· More domains hosted on 66.60.193.40
 
N/A
46 Domain: kaiserp.org
· 208.87.149.250
· More domains hosted on 208.87.149.250
 
N/A
47 Domain: kaiserpackers.org
· 64.202.189.170
· More domains hosted on 64.202.189.170
 
N/A
48 Domain: kaiserpapers.org
· 208.109.156.217
· More domains hosted on 208.109.156.217
 
N/A
49 Domain: kaiserpapershawaii.org
· 75.126.41.187
· More domains hosted on 75.126.41.187
 
N/A
50 Domain: kaiserpapersnorthwest.org
· 74.53.104.118
· More domains hosted on 74.53.104.118
 
N/A
51 Domain: kaiserparkshadelands.org
· 216.243.74.30
· More domains hosted on 216.243.74.30
 
N/A
52 Domain: kaiserparmanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
53 Domain: kaiserpeemanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
54 Domain: kaiserpefmanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
55 Domain: kaiserpegmanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
56 Domain: kaiserpemante.org
· 64.20.60.99
· More domains hosted on 64.20.60.99
· 64.20.60.106
· More domains hosted on 64.20.60.106
· 64.20.62.35
· More domains hosted on 64.20.62.35
 
N/A
57 Domain: kaiserper.org
· 216.188.26.235
· More domains hosted on 216.188.26.235
· 216.188.26.237
· More domains hosted on 216.188.26.237
 
N/A
58 Domain: kaiserperamente.org
· 208.87.149.250
· More domains hosted on 208.87.149.250
 
N/A
59 Domain: kaiserperanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
60 Domain: kaiserperformanceandrisk.org
· 69.72.142.98
· More domains hosted on 69.72.142.98
· 216.98.141.250
· More domains hosted on 216.98.141.250
 
N/A
61 Domain: kaiserperjanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
62 Domain: kaiserperkanente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
63 Domain: kaiserperm.org
· 216.8.179.26
· More domains hosted on 216.8.179.26
 
N/A
64 Domain: kaiserpermabente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
65 Domain: kaiserpermaente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
66 Domain: kaiserpermahente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
67 Domain: kaiserpermamente.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
68 Domain: kaiserpermamnente.org
· 64.20.60.99
· More domains hosted on 64.20.60.99
· 64.20.60.106
· More domains hosted on 64.20.60.106
· 64.20.62.35
· More domains hosted on 64.20.62.35
 
N/A
69 Domain: kaiserpermananente.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
70 Domain: kaiserpermanante.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
71 Domain: kaiserpermanantejobs.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
72 Domain: kaiserpermanate.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
73 Domain: kaiserpermanehte.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
74 Domain: kaiserpermanenente.org
· 208.87.149.250
· More domains hosted on 208.87.149.250
 
N/A
75 Domain: kaiserpermanenete.org
· 64.195.235.123
· More domains hosted on 64.195.235.123
 
N/A
76 Domain: kaiserpermanenetejobs.org
· 216.188.26.235
· More domains hosted on 216.188.26.235
· 216.188.26.237
· More domains hosted on 216.188.26.237
 
N/A
77 Domain: kaiserpermanenge.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
78 Domain: kaiserpermanente-california.org
· 68.178.232.100
· More domains hosted on 68.178.232.100
 
N/A
79 Domain: kaiserpermanente-mail.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
80 Domain: kaiserpermanente.org
· 162.119.234.68
· More domains hosted on 162.119.234.68
 
N/A
81 Domain: kaiserpermanenteca.org
· 69.6.21.21
· More domains hosted on 69.6.21.21
 
N/A
82 Domain: kaiserpermanentecalifornia.org
· 68.178.232.100
· More domains hosted on 68.178.232.100
 
N/A
83 Domain: kaiserpermanentechoices.org
· 68.125.46.137
· More domains hosted on 68.125.46.137
 
N/A
84 Domain: kaiserpermanentecolorado.org
· 64.78.181.43
· More domains hosted on 64.78.181.43
 
N/A
85 Domain: kaiserpermanentecomplaints.org
· 74.53.27.101
· More domains hosted on 74.53.27.101
 
N/A
86 Domain: kaiserpermanentedirect.org
· 64.26.61.73
· More domains hosted on 64.26.61.73
 
N/A
87 Domain: kaiserpermanentehawaii.org
· 74.53.27.98
· More domains hosted on 74.53.27.98
 
N/A
88 Domain: kaiserpermanentehealthylifeski
lls.org

· 205.210.42.13
· More domains hosted on 205.210.42.13
 
N/A
89 Domain: kaiserpermanentehospital.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
90 Domain: kaiserpermanentehumanresources
.org

· 208.87.149.250
· More domains hosted on 208.87.149.250
 
N/A
91 Domain: kaiserpermanenteinsurance.org
· 68.178.232.100
· More domains hosted on 68.178.232.100
 
N/A
92 Domain: kaiserpermanentejob.org
· 69.25.47.166
· More domains hosted on 69.25.47.166
· 66.150.161.44
· More domains hosted on 66.150.161.44
 
N/A
93 Domain: kaiserpermanentejobs.org
· 63.131.135.96
· More domains hosted on 63.131.135.96
 
N/A
94 Domain: kaiserpermanentelearntothrive.
org

· 205.210.42.13
· More domains hosted on 205.210.42.13
 
N/A
95 Domain: kaiserpermanentemedical.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
96 Domain: kaiserpermanentemembers.org
· 216.188.26.237
· More domains hosted on 216.188.26.237
· 216.188.26.235
· More domains hosted on 216.188.26.235
 
N/A
97 Domain: kaiserpermanentenewscenter.org
· 208.73.210.50
· More domains hosted on 208.73.210.50
 
N/A
98 Domain: kaiserpermanenter.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A
99 Domain: kaiserpermanentethrive.org
· 205.210.42.13
· More domains hosted on 205.210.42.13
 
N/A
100 Domain: kaiserpermanentjobs.org
· 208.73.210.121
· More domains hosted on 208.73.210.121
 
N/A